Filter By
Filter Reset
Exam Types
  • All Exams
  • Final (4)
Semester
Study Guides (298,823)
AUS (8,311)
UQ (823)
BIOC (4)
BIOC2000 (4)

Study Guides for BIOC2000 at University of Queensland

Biochemistry & Molecular Biology

BIOC2000 Study Guide - Final Guide: Green Fluorescent Protein, Molecular Mass, Glutathione
Premium

GFP >spP42212GFP_AEQVI Green fluorescent protein OS=Aequorea victoria OX=6100 GN=GFP PE=1 SV=1 MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIEL...

Biochemistry
BIOC2000
Dr Justin Ridge
BIOC2000 Study Guide - Final Guide: Protein Folding, Conformational Entropy, Alpha Helix
Premium

Sunday, 10 June, 2018 Rowland and kings protein folding Protein folding Stability = ability to maintain native conformation unfolded protein have high degree of conformational entropy, protein maintain its native conform...

Biochemistry
BIOC2000
Dr Justin Ridge
BIOC2000 Study Guide - Final Guide: Glucokinase, Hexokinase
Premium

Tuesday, 5 June, 2018 Michaelis Menten Equation [E]+[S] <> [ES] > [E]+[P] Derive Mentens Equation from Vo Vmax and Km using steady sate assumption K1 K1 K2; assume no k2 Km=rate of disassociationrate of association = k1...

Biochemistry
BIOC2000
Dr Justin Ridge
BIOC2000 Study Guide - Final Guide: Glycogen, Atp Synthase, Hexokinase
Premium

Saturday, 2 June, 2018 Revision notes Summary RIDGE Gloucose 01 Flux amount of flow along a pathway Determined by input, output and activity of enzymes in the pathway Pools amounts of molecules Filled and emptied by pa...

Biochemistry
BIOC2000
Dr Justin Ridge
Get Study Guides for BIOC2000 at University of Queensland

We are currently building a library of Study Guides for BIOC2000 at University of Queensland. Request and we’ll let you know once it’s available.

Thank you! We have received your request.

Log In


OR

Don't have an account?

Join OneClass

Access over 10 million pages of study
documents for 1.3 million courses.

Sign up

Join to view


OR

By registering, I agree to the Terms and Privacy Policies
Already have an account?
Just a few more details

So we can recommend you notes for your school.

Reset Password

Please enter below the email address you registered with and we will send you a link to reset your password.

Add your courses

Get notes from the top students in your class.


Submit