Class Notes (836,518)
Canada (509,851)
Anthropology (1,596)
ANTC23H3 (18)
Lecture

Mate Choice

1 Page
74 Views
Unlock Document

Department
Anthropology
Course
ANTC23H3
Professor
Joyce Parga
Semester
Summer

Description
Announcement:Midtermnextweek.Questionsfromreadingandlecture.Knowtermsanddefinitions MateChoice givenintextreadingandinthelectureslides. May-29-12 1:00 PM FinishfromLast Week- Infanticide Whatdo femalesselectfor Femalematechoicein humans(indirect) MaleMateChoice - Malesexuallyselectedinfanticide ○ Directbenefits ○ Femalesselectingforhigh-statusmen - Malebaboonsandchimpswillturndown inhumans?  Infantcare  Judgebasedonfacialfeatures opportunitiestocopulatewithveryyoung ○ Higherratesofchildmurder  Resources(ie.Food) □ Dom=prominentchin, females(notattractivetomales) bystep-parentsthangenetic  Protectionofselfandinfant heavybrowridges, - Ageoffemalesandreproduction parents ○ Indirectbenefits muscularface ○ Mostfemaleprimateswillpeakinmiddle-  Highestriskforyoung  Geneticbenefits □ LowDom= 'weak'chin, agerange childrentwoyearsor  Superiorgenesforoffspring slightbrowridges,fleshy ○ OldandyounginfantshavepoorRS; less (basedonbody face reproductivesenescenceinoldage ○ Childrenareabusedmore morphology,physical ○ Potentiallyproblematicwithshifting - Mostpreferredfemalesdependsonspecies oftenbystep-parentsthanif ability) socialpositioningoffemalestatus ○ RTL:prime-agedfemales(4-9years); theylivewithbothgenetic  Complementarygenes(not ○ MHC - Majorhistocompatibility highestRSandinfantsurvival parents closelyrelatedtoyou, complex:clusterofhighlyvariable ○ Chimp:Olderfemales(upto50years);may - Humanmalematingstrategies increasedgenetic genesthatcodeforcell-surface havebettermaternalskills(longertimeto ○ Long-term strategy variability) moleculesthatcontrolimmunological learn),mayhavebettergeneticquality  Commitmenttoa SelectingforDirectbenefits activity[HLA-humanleukocyte indicatedbyabilitytolivethatlong singlefemale ○ Choosingmale'friends'andmates antigen-inhumans] HumanMale Mate Choice □ Decreased  Receiveservicesfromthe  Genesthatcontrolimmunological - Healthandyouthas focusofmateselection;high numberof malelikegrooming activity;what'matches'when reproductivepotential sexualpartners  Careforoffspringand doingtransplants - Cuesoffemaleage □ Highinvestment protectionfrominfanticidal  Whereyourbodysensesselfand ○ Waisttohipratio (WHR) infemaleand males no
More Less

Related notes for ANTC23H3

Log In


OR

Join OneClass

Access over 10 million pages of study
documents for 1.3 million courses.

Sign up

Join to view


OR

By registering, I agree to the Terms and Privacy Policies
Already have an account?
Just a few more details

So we can recommend you notes for your school.

Reset Password

Please enter below the email address you registered with and we will send you a link to reset your password.

Add your courses

Get notes from the top students in your class.


Submit